PDB entry 2mna

View 2mna on RCSB PDB site
Description: The structural basis of DNA binding by the single-stranded DNA-binding protein from Sulfolobus solfataricus
Class: DNA binding protein/DNA
Keywords: DNA repair, SSB, Sulfolobus solfataricus, DNA BINDING PROTEIN-DNA complex
Deposited on 2014-04-02, released 2014-12-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-17, with a file datestamp of 2014-12-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Single-stranded DNA binding protein (SSB)
  Species: Sulfolobus solfataricus [TaxId:273057]
  Gene: SSB, SSO2364
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q97W73 (0-113)
    • expression tag (114-116)
  Domains in SCOPe 2.05: d2mnaa_
• Chain 'B':
  Compound: ssDNA
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mnaA (A:)
  meekvgnlkpnmesvnvtvrvleasearqiqtkngvrtiseaivgdetgrvkltlwgkha
  gsikegqvvkienawttafkgqvqlnagsktkiaeasedgfpessqipentptarrr
  

  
  
• Chain 'B':
  No sequence available.