PDB entry 2mmx

View 2mmx on RCSB PDB site
Description: NMR study of 6aJL2
Class: immune system
Keywords: light chain, amyloidosis, systemic, lambda, IMMUNE SYSTEM
Deposited on 2014-03-20, released 2014-06-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: v1-22 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: V1-22
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5NV88 (0-97)
    • expression tag (98-110)
  Domains in SCOPe 2.05: d2mmxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2mmxA (A:)
  nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
  drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl