PDB entry 2m99

View 2m99 on RCSB PDB site
Description: Solution structure of a chymotrypsin inhibitor from the Taiwan cobra
Class: hydrolase inhibitor
Keywords: Naja naja atra, chymotrypsin inhibitor, NACI, HYDROLASE INHIBITOR
Deposited on 2013-06-05, released 2013-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-16, with a file datestamp of 2013-10-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease inhibitor NACI
    Species: Naja atra [TaxId:8656]
    Gene: aci
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m99a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2m99A (A:)
rprfcelapsagscfafvpsyyynqysntchsftysgcggnanrfrtidecnrtcvg