PDB entry 2m94

View 2m94 on RCSB PDB site
Description: NMR structure of the lymphocyte receptor NKR-P1A
Class: immune system receptor
Keywords: NK cells, NK receptor, NKR-P1A, C-type lectin-like domain, IMMUNORECEPTOR, IMMUNE SYSTEM RECEPTOR
Deposited on 2013-05-31, released 2014-06-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Killer cell lectin-like receptor subfamily B member 1A
    Species: Mus musculus [TaxId:10090]
    Gene: Klrb1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2m94a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2m94A (A:)
    saklecpqdwlshrdkcfhvsqvsntweeglvdcdgkgatlmliqdqeelrflldsikek
    ynsfwiglrytlpdmnwkwingstlnsdvlkitgdtendscaaisgdkvtfescnsdnrw
    icqkelyhetlsnyvgygh