PDB entry 2m8h

View 2m8h on RCSB PDB site
Description: RRM domain of human RBM7
Class: RNA binding protein
Keywords: binding protein, RNA binding protein
Deposited on 2013-05-21, released 2015-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: RNA-binding protein 7
  Species: Homo sapiens [TaxId:9606]
  Gene: RBM7
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9Y580 (10-100)
    • expression tag (0-9)
    • conflict (11)
  Domains in SCOPe 2.05: d2m8ha_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2m8hA (A:)
  gsefelrrqqalaeadrtlfvgnletkvteellfelfhqagpvikvkipkdkdgkpkqfa
  fvnfkhevsvpyamnllngiklygrpikiqfrsgsshapqd