PDB entry 2lnh

View 2lnh on RCSB PDB site
Description: Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin assembly
Class: Signaling Protein/Protein Binding
Keywords: Protein complex, Signaling Protein-Protein Binding complex
Deposited on 2011-12-28, released 2012-08-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-31, with a file datestamp of 2012-10-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural Wiskott-Aldrich syndrome protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Wasl
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00401 (1-64)
      • expression tag (0)
  • Chain 'B':
    Compound: Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BAIAP2L1, IRTKS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHR4 (3-66)
      • expression tag (0-2)
    Domains in SCOPe 2.05: d2lnhb_
  • Chain 'C':
    Compound: Secreted effector protein EspF(U)
    Species: Escherichia coli O157:H7 [TaxId:83334]
    Gene: espF(U), tccP
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lnhB (B:)
gshmkkqkvktifphtagsnktllsfaqgdvitllipeekdgwlygehdvskargwfpss
ytkllee

  • Chain 'C':
    No sequence available.