PDB entry 2lmr

View 2lmr on RCSB PDB site
Description: Solution structure of the first sam domain of odin
Class: signaling protein
Keywords: signaling protein
Deposited on 2011-12-12, released 2012-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin repeat and SAM domain-containing protein 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: ANKS1A, ANKS1, KIAA0229, ODIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92625 (21-100)
      • expression tag (20)
    Domains in SCOPe 2.05: d2lmra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2lmrA (A:)
mgsshhhhhhssglvprgshmisglrtleqsvgewlesiglqqyesklllngfddvhflg
snvmeeqdlrdigisdpqhrrkllqaarslpkvkalgydgn

    Sequence, based on observed residues (ATOM records): (download) 
    >2lmrA (A:)
misglrtleqsvgewlesiglqqyesklllngfddvhflgsnvmeeqdlrdigisdpqhr
rkllqaarslpkvkalgydgn