PDB entry 2li7

View 2li7 on RCSB PDB site
Description: Solution Structure of CssII
Class: toxin
Keywords: CssII, alfa beta scorpion toxin, TOXIN
Deposited on 2011-08-24, released 2012-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-mammal toxin Css2
  Species: Centruroides suffusus suffusus [TaxId:6881]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08900 (0-65)
  Domains in SCOPe 2.06: d2li7a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2li7A (A:)
  kegylvskstgckyeclklgdndyclreckqqygkssggycyafacwcthlyeqavvwpl
  pnktcn