PDB entry 2l4s

View 2l4s on RCSB PDB site
Description: Promiscuous Binding at the Crossroads of Numerous Cancer Pathways: Insight from the Binding of GIP with Glutaminase L
Class: peptide binding protein
Keywords: PDZ domain, GIP, Glutatminase L, PEPTIDE BINDING PROTEIN
Deposited on 2010-10-13, released 2011-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2l4sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l4sA (A:)
    msyipgqpvtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrv
    seggpaeiaglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq
    smls