PDB entry 2l3v

View 2l3v on RCSB PDB site
Description: NMR structure of Acyl carrier protein from Brucella melitensis
Class: lipid binding protein
Keywords: Acyl carrier protein, Brucella melitensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, LIPID BINDING PROTEIN
Deposited on 2010-09-23, released 2010-10-06
Made obsolete by 2n57 on 2015-07-22

The last revision prior to the SCOPe 2.04 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Brucella melitensis [TaxId:520466]
  Gene: acpP, BAOG_00187
  Database cross-references and differences (RAF-indexed):
  • Uniprot D1F788 (1-78)
    • expression tag (0)
  Domains in SCOPe 2.04: d2l3va_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l3vA (A:)
  smsdtaervkkivvehlgvdadkvtegasfiddlgadsldtvelvmafeeefgveipdda
  aetiltvgdavkfidkasa