PDB entry 2n57

View 2n57 on RCSB PDB site
Description: nmr structure of acyl carrier protein from brucella melitensis
Deposited on 2015-07-08, released 2015-07-22
The last revision was dated 2015-07-22, with a file datestamp of 2015-07-17.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl carrier protein
    Species: Brucella melitensis bv. 3 str. Ether [TaxId:520466]
    Gene: acpP, BAOG_00187
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.04, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2n57A (A:)
msdtaervkkivvehlgvdadkvtegasfiddlgadsldtvelvmafeeefgveipddaa
etiltvgdavkfidkasa