PDB entry 2kv8

View 2kv8 on RCSB PDB site
Description: Solution structure ofRGS12 PDZ domain
Class: signaling protein
Keywords: pdz domain, SIGNALING PROTEIN
Deposited on 2010-03-10, released 2011-03-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of G-protein signaling 12
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14924 (0-82)
  Domains in SCOPe 2.05: d2kv8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kv8A (A:)
  prvrsvevargragygftlsgqapcvlscvmrgspadfvglragdqilavneinvkkash
  edvvkligkcsgvlhmviaegvg