PDB entry 2ksu

View 2ksu on RCSB PDB site
Description: Redox linked conformational changes in cytochrome C3 from Desulfovibrio desulfuricans ATCC 27774
Class: electron transport
Keywords: Desulfovibrio Desulfuricans, ATCC 27774, multihaem cytochrome, fully reduced, ELECTRON TRANSPORT
Deposited on 2010-01-13, released 2010-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome c3
  Species: Desulfovibrio desulfuricans [TaxId:525146]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9L915 (0-106)
    • see remark 999 (70)
  Domains in SCOPe 2.08: d2ksua_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ksuA (A:)
  apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
  ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp