PDB entry 2ksp

View 2ksp on RCSB PDB site
Description: Mechanism for the selective interaction of C-terminal EH-domain proteins with specific NPF-containing partners
Class: protein binding
Keywords: EHD1, endocytic recycling, protein-protein interactions, PROTEIN BINDING
Deposited on 2010-01-11, released 2010-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EH domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EHD1, PAST, PAST1, CDABP0131
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H4M9 (5-104)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d2kspa1, d2kspa2
  • Chain 'B':
    Compound: MICAL L1 like peptide
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kspA (A:)
    gplgsddvewvvgkdkptydeifytlspvngkitganakkemvksklpntvlgkiwklad
    vdkdgllddeefalanhlikvkleghelpadlpphlvppskrrhe
    

  • Chain 'B':
    No sequence available.