PDB entry 2kri

View 2kri on RCSB PDB site
Description: Structure of a complex between domain V of beta2-glycoprotein I and the fourth ligand-binding module from LDLR determined with Haddock
Class: protein binding/endocytosis
Keywords: Antiphospholipid syndrome, Thrombosis, LDLR, Receptor, Disulfide bond, Glycoprotein, Heparin-binding, Sushi, PROTEIN BINDING-ENDOCYTOSIS complex
Deposited on 2009-12-18, released 2010-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2-glycoprotein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: APOH, B2G1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02749 (Start-83)
      • conflict (4)
    Domains in SCOPe 2.06: d2kria_
  • Chain 'B':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2krib_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2kriA (A:)
    gscklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtie
    vpkcfkehsslafwktdasdvkpca
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kriA (A:)
    cklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtievp
    kcfkehsslafwktdasdvkpc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2kriB (B:)
    tcgpasfqcnsstcipqlwacdndpdcedgsdewpqrcrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2kriB (B:)
    tcgpasfqcnsstcipqlwacdndpdcedgsdewpqrc