PDB entry 2khs

View 2khs on RCSB PDB site
Description: Solution structure of SNase121:SNase(111-143) complex
Class: hydrolase
Keywords: HYDROLASE, Calcium, Endonuclease, Membrane, Metal-binding, Nuclease, Secreted, Zymogen
Deposited on 2009-04-10, released 2009-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-20, with a file datestamp of 2009-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2khsa_
  • Chain 'B':
    Compound: Nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1WCB7 (2-34)
      • expression tag (0-1)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2khsA (A:)
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
h

  • Chain 'B':
    No sequence available.