PDB entry 2kg2

View 2kg2 on RCSB PDB site
Description: Solution structure of a PDZ protein
Class: protein binding
Keywords: PDZ domain, Cytoplasm, Nucleus, Phosphoprotein, Wnt signaling pathway
Deposited on 2009-03-02, released 2010-01-19
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-01-19, with a file datestamp of 2010-01-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tax1-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: TAX1BP3, TIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14907 (1-123)
      • expression tag (0)
    Domains in SCOPe 2.05: d2kg2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kg2A (A:)
    gsyipgqpvtavvqrveihklrqgenlilgfsigggidqdpsqnpfsedktdkgiyvtrv
    seggpaeiaglqigdkimqvngwdmtmvthdqarkrltkrseevvrllvtrqslqkavqq
    smls