PDB entry 2kft

View 2kft on RCSB PDB site
Description: NMR Solution structure of the first PHD finger domain of human Autoimmune Regulator (AIRE) in complex with Histone H3(1-20Cys) Peptide
Class: transcription/protein binding
Keywords: PHD Finger, Histone Code, AIRE, APECED, Transcription, Alternative splicing, Cytoplasm, Disease mutation, DNA-binding, Metal-binding, Nucleus, Phosphoprotein, Polymorphism, Transcription regulation, Zinc, Zinc-finger, Chromosomal protein, Nucleosome core, TRANSCRIPTION/PROTEIN BINDING COMPLEX
Deposited on 2009-02-27, released 2009-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-26, with a file datestamp of 2009-05-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoimmune regulator
    Species: Homo sapiens [TaxId:9606]
    Gene: AIRE, APECED
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43918 (2-55)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2kfta1, d2kfta2
  • Chain 'B':
    Compound: histone h3
    Database cross-references and differences (RAF-indexed):
    • PDB 2KFT (0-20)
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kftA (A:)
    gsknedecavcrdggeliccdgcprafhlaclspplreipsgtwrcssclqatvqe
    

  • Chain 'B':
    No sequence available.