PDB entry 2kbk

View 2kbk on RCSB PDB site
Description: Solution Structure of BmK-M10
Class: toxin
Keywords: protein, Ionic channel inhibitor, Neurotoxin, Secreted, Sodium channel inhibitor, Toxin
Deposited on 2008-11-28, released 2009-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurotoxin BmK-M10
  Species: Mesobuthus martensii [TaxId:34649]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O61705 (0-63)
  Domains in SCOPe 2.06: d2kbka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kbkA (A:)
  vrdayiakpencvyecgitqdcnklctengaesgycqwggkygnacwciklpdsvpirvp
  gkcq