PDB entry 2kaj

View 2kaj on RCSB PDB site
Description: NMR structure of gallium substituted ferredoxin
Class: metal binding protein
Keywords: ferredoxin, iron-sulfur, Electron transport, Iron, Metal binding protein, Transport
Deposited on 2008-11-06, released 2009-11-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-1
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: petF, fed, ssl0020
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2kaja_
  • Heterogens: GA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kajA (A:)
    asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
    qsfldddqieagyvltcvayptsdctiethkeedly