PDB entry 2k4p

View 2k4p on RCSB PDB site
Description: Solution Structure of Ship2-Sam
Class: signaling protein
Keywords: Helix bundle, signaling protein, Actin-binding, Alternative splicing, Cell adhesion, Cytoplasm, Cytoskeleton, Diabetes mellitus, Hydrolase, Immune response, Membrane, Phosphoprotein, Polymorphism, SH2 domain, SH3-binding
Deposited on 2008-06-16, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-03-03, with a file datestamp of 2009-02-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: INPPL1, SHIP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2k4pa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2k4pA (A:)
mgsshhhhhhssglvprgshmsglgeagmsawlraigleryeeglvhngwddleflsdit
eedleeagvqdpahkrllldtlqlsk

    Sequence, based on observed residues (ATOM records): (download) 
    >2k4pA (A:)
sglgeagmsawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldt
lqlsk