PDB entry 2k2f
View 2k2f on RCSB PDB site
Description: Solution structure of Ca2+-S100A1-RyRP12
Class: metal binding protein
Keywords: S100, EF hand, ryanodine receptor, calcium binding, Alternative splicing, Calcium channel, Calcium transport, Glycoprotein, Ion transport, Ionic channel, Membrane, Polymorphism, Transmembrane, Transport, Cytoplasm, Metal-binding, Zinc, METAL BINDING PROTEIN
Deposited on
2008-04-01, released
2008-07-29
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein S100-A1
Species: Rattus norvegicus
Gene: S100a1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2k2fa_ - Chain 'B':
Compound: Protein S100-A1
Species: Rattus norvegicus
Gene: S100a1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d2k2fb_ - Chain 'C':
Compound: Ryanodine receptor 1 peptide
Species: Rattus norvegicus
Gene: RYR1
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Ryanodine receptor 1 peptide
Species: Rattus norvegicus
Gene: RYR1
Database cross-references and differences (RAF-indexed):
- Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2k2fA (A:)
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2k2fB (B:)
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.