PDB entry 2jxo

View 2jxo on RCSB PDB site
Description: Structure of the second PDZ domain of NHERF-1
Class: protein binding
Keywords: NHERF-1, PDZ domain, PDZ2, Acetylation, Cell projection, Membrane, Phosphoprotein, Polymorphism, Wnt signaling pathway, PROTEIN BINDING
Deposited on 2007-11-27, released 2008-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ezrin-radixin-moesin-binding phosphoprotein 50
  Species: Homo sapiens [TaxId:9606]
  Gene: SLC9A3R1, NHERF
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14745 (7-97)
    • expression tag (0-6)
  Domains in SCOPe 2.06: d2jxoa1, d2jxoa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2jxoA (A:)
  gidpftmlrprlctmkkgpsgygfnlhsdkskpgqfirsvdpdspaeasglraqdrivev
  ngvcmegkqhgdvvsairaggdetkllvvdretdeffk