PDB entry 2jto

View 2jto on RCSB PDB site
Description: Solution Structure of Tick Carboxypeptidase Inhibitor
Class: hydrolase inhibitor
Keywords: PROTEIN, Blood coagulation, Fibrinolysis, Metalloenzyme inhibitor, Metalloprotease inhibitor, Secreted, HYDROLASE INHIBITOR
Deposited on 2007-08-03, released 2008-07-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase inhibitor
    Species: Rhipicephalus bursa
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2jtoa1, d2jtoa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jtoA (A:)
    necvskgfgclpqsdcpqearlsyggcstvccdlskltgckgkggecnpldrqckelqae
    sascgkgqkccvwlh