PDB entry 2jph

View 2jph on RCSB PDB site
Description: NMR solution structure of the Rho GTPase binding domain of human plexin-b1
Class: signaling protein, protein binding
Keywords: protein, ubiquitin fold, SIGNALING PROTEIN, PROTEIN BINDING
Deposited on 2007-05-11, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plexin-B1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLXNB1, KIAA0407, SEP
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43157 (3-122)
      • expression tag (1-2)
      • engineered (90)
    Domains in SCOPe 2.06: d2jpha1, d2jpha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2jphA (A:)
mkkdveyrpltlnallavgpgageaqgvpvkvldcdtisqakekmldqlykgvpltqrpd
prtldvewrsgvaghlilsdedvtsevqglfrrlntlqhykvpdgatvalvpcltkhvlr
enq

    Sequence, based on observed residues (ATOM records): (download) 
    >2jphA (A:)
kkdveyrpltlnallavgpgageaqgvpvkvldcdtisqakekmldqlykgvpltqrpdp
rtldvewrsgvaghlilsdedvtsevqglfrrlntlqhykvpdgatvalvpcltkhvlre
nq