PDB entry 2jn8
View 2jn8 on RCSB PDB site
Description: Solution NMR structure of Q8ZRJ2 from Salmonella typhimurium. Northeast Structural Genomics target StR65.
Class: structural genomics, unknown function
Keywords: NMR structure, NESG, PSI-2, AutoStructure, Structural Genomics, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on
2006-12-29, released
2007-01-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: putative cytoplasmic protein
Species: Salmonella typhimurium [TaxId:602]
Gene: STM0327
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZRJ2 (Start-106)
- cloning artifact (107-108)
- expression tag (109)
Domains in SCOPe 2.08: d2jn8a1, d2jn8a2
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2jn8A (A:)
mvnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvar
geqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvlehhhhhh
Sequence, based on observed residues (ATOM records): (download)
>2jn8A (A:)
vnfkdksmptaiekaldfiggmntsasvphsmdestakgilkylhdlgvpvspevvvarg
eqegwnpeftkkvagwaekvasgnriliknpeyfstymqeqlkelvleh