PDB entry 2jin

View 2jin on RCSB PDB site
Description: crystal structure of pdz domain of synaptojanin-2 binding protein
Class: membrane protein
Keywords: transmembrane, outer membrane, mitochondria distribution, pdz, membrane, scaffold, mitochondrion, membrane protein
Deposited on 2007-06-28, released 2007-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.169
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: synaptojanin-2 binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2JIN (98-101)
    • Uniprot P57105 (2-97)
    Domains in SCOPe 2.05: d2jina_
  • Heterogens: NA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2jinA (A:)
    smrvdylvteeeinltrgpsglgfnivggtdqqyvsndsgiyvsrikengaaaldgrlqe
    gdkilsvngqdlknllhqdavdlfrnagyavslrvqhressi