PDB entry 2je4

View 2je4 on RCSB PDB site
Description: atomic-resolution crystal structure of chemically-synthesized hiv-1 protease in complex with jg-365
Class: hydrolase/hydrolase inhibitor
Keywords: protease, hydrolase, high resolution, aspartyl protease, human immunodeficiency virus 1, hydrolase-hydrolase inhibitor complex
Deposited on 2007-01-15, released 2007-08-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.144
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • conflict (6)
    • conflict (32)
  Domains in SCOPe 2.01: d2je4a_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • conflict (6)
    • conflict (32)
  Domains in SCOPe 2.01: d2je4b_
• Chain 'C':
  Compound: inhibitor molecule jg365
  Database cross-references and differences (RAF-indexed):
  • PDB 2JE4 (Start-5)
• Heterogens: ACT, GOL, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2je4A (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgkwkpkliggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2je4B (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgkwkpkliggiggfikvrqyd
  qipveiaghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'C':
  No sequence available.