PDB entry 2j1t

View 2j1t on RCSB PDB site
Description: structure of a streptococcus pneumoniae fucose binding module in complex with the lewis y antigen
Class: carbohydrate-binding protein
Keywords: carbohydrate-binding protein, carbohydrate binding protein
Deposited on 2006-08-15, released 2006-09-06
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.151
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fucolectin-related protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fucolectin-related protein
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • PDB 2J1T
    • Uniprot Q97N96 (Start-150)
    Domains in SCOPe 2.02: d2j1tb_
  • Heterogens: FUC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2j1tB (B:)
    gshmastpdkfndgnlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnp
    swwevdlkkmdkvglvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsld
    fkekgaryikvklltsgvplslaevevfres
    

    Sequence, based on observed residues (ATOM records): (download)
    >2j1tB (B:)
    nlniayakpttqssvdyngdpnravdgnrngnfnsgsvthtradnpswwevdlkkmdkvg
    lvkiynrtdaetqrlsnfdvilydnnrnevakkhvnnlsgesvsldfkekgaryikvkll
    tsgvplslaevevfres