PDB entry 2iwd

View 2iwd on RCSB PDB site
Description: oxacilloyl-acylated mecr1 extracellular antibiotic-sensor domain.
Class: antibiotic resistance
Keywords: bacterial antibiotic resistance, oxacillin, beta-lactamase, mrsa, antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, penicillin-binding protein
Deposited on 2006-06-27, released 2006-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: methicillin resistance mecr1 protein
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A0B0 (0-245)
  Domains in SCOPe 2.06: d2iwda_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2iwdA (A:)
  dkyetnvsykklnqlapyfkgfdgsfvlynereqaysiynepeskqryspnstykiylal
  mafdqnllslnhteqqwdkhqypfkewnqdqnlnssmkysvnwyyenlnkhlrqdevksy
  ldlieygneeisgnenywnesslkisaieqvnllknmkqhnmhfdnkaiekvensmtlkq
  kdtykyvgktgtgivnhkeangwfvgyvetkdntyyfathlkgednangekaqqiseril
  kemeli