PDB entry 2iw8

View 2iw8 on RCSB PDB site
Description: structure of human thr160-phospho cdk2-cyclin a f82h-l83v-h84d mutant with an o6-cyclohexylmethylguanine inhibitor
Class: cell cycle
Keywords: phosphorylation, nucleotide-binding, serine/threonine-protein kinase, cell cycle complex, kinase, mitosis, cell cycle, transferase
Deposited on 2006-06-27, released 2006-09-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
      • engineered mutation (85-87)
    Domains in SCOPe 2.07: d2iw8a1, d2iw8a2
  • Chain 'B':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iw8b1, d2iw8b2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (4-End)
      • expression tag (3)
      • engineered mutation (85-87)
    Domains in SCOPe 2.07: d2iw8c2, d2iw8c3
  • Chain 'D':
    Compound: Cyclin-A2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2iw8d1, d2iw8d2
  • Heterogens: 4SP, SGM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2iw8A (A:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw8A (A:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2iw8B (B:)
    mevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw8B (B:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyittytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2iw8C (C:)
    gpgsmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw8C (C:)
    smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfehvdqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgvppldedgrsllsqmlhyd
    pnkrisakaalahpffqdvtkpvphl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2iw8D (D:)
    mevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetl
    hlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvl
    rmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylp
    sviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirek
    yknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2iw8D (D:)
    yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
    yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetlnl