PDB entry 2i1n

View 2i1n on RCSB PDB site
Description: Crystal structure of the 1st PDZ domain of Human DLG3
Class: signaling protein
Keywords: DLG3, PDZ, PDZ domain, signal transduction, structural genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2006-08-14, released 2006-09-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Discs, large homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JUW7 (1-97)
      • cloning artifact (98-101)
    Domains in SCOPe 2.05: d2i1na_
  • Chain 'B':
    Compound: Discs, large homolog 3
    Species: Homo sapiens [TaxId:9606]
    Gene: DLG3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5JUW7 (1-97)
      • cloning artifact (0)
      • cloning artifact (98-101)
    Domains in SCOPe 2.05: d2i1nb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2i1nA (A:)
    smfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvl
    rvnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2i1nA (A:)
    mfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvlr
    vnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2i1nB (B:)
    smfkyeeivlergnsglgfsiaggidnphvpddpgifitkiipggaaamdgrlgvndcvl
    rvnevdvsevvhsravealkeagpvvrlvvrrrqpppeetsv