PDB entry 2hx5

View 2hx5 on RCSB PDB site
Description: Crystal structure of a putative thioesterase (pmt_2055) from prochlorococcus marinus str. mit 9313 at 1.50 A resolution
Class: hydrolase
Keywords: Thioesterase/thiol ester dehydrase-isomerase fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase
Deposited on 2006-08-02, released 2006-08-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.155
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: PROCHLOROCOCCUS MARINUS [TaxId:74547]
    Gene: NP_895880.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7V4A7 (1-End)
      • modified residue (1)
      • modified residue (24)
      • modified residue (87)
    Domains in SCOPe 2.06: d2hx5a1
  • Heterogens: ETX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hx5A (A:)
gmnpenwlllrrvvrfgdtdaagvmhfhqlfrwchesweeslesyglnpadifpgsrkse
vtpevalpiihcqadfrrpihtgdalamelrperlnpnsfqvhfefrceeqiaahalirh
lainaqtrhrcalpegidrwleasgvgkigsi

    Sequence, based on observed residues (ATOM records): (download) 
    >2hx5A (A:)
mnpenwlllrrvvrfgdtdaagvmhfhqlfrwchesweeslesyglnpadifpgsrksev
tpevalpiihcqadfrrpihtgdalamelrperlnpnsfqvhfefrceeqiaahalirhl
ainaqtrhrcalpegidrwleasg