PDB entry 2hpe

View 2hpe on RCSB PDB site
Description: comparison of the structures of hiv-2 protease complexes in three crystal space groups with an hiv-1 protease complex structure
Class: hydrolase(acid protease)
Keywords: hydrolase(acid protease)
Deposited on 1994-09-21, released 1994-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
    • conflict (56)
  Domains in SCOPe 2.06: d2hpea_
• Chain 'B':
  Compound: hiv-2 protease
  Species: Human immunodeficiency virus 2 [TaxId:11709]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04584 (0-98)
    • conflict (56)
  Domains in SCOPe 2.06: d2hpeb_
• Chain 'S':
  Compound: unidentified peptide fragment
  Database cross-references and differences (RAF-indexed):
  • PDB 2HPE (0-8)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hpeA (A:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hpeB (B:)
  pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
  nveievlnkkvratimtgdtpinifgrniltalgmslnl
  

  
  
• Chain 'S':
  No sequence available.