PDB entry 2hpe

View 2hpe on RCSB PDB site
Description: comparison of the structures of hiv-2 protease complexes in three crystal space groups with an hiv-1 protease complex structure
Class: hydrolase(acid protease)
Keywords: hydrolase(acid protease)
Deposited on 1994-09-21, released 1994-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.15
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-2 protease
    Species: Human immunodeficiency virus 2 [TaxId:11709]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04584 (0-98)
      • conflict (56)
    Domains in SCOPe 2.05: d2hpea_
  • Chain 'B':
    Compound: hiv-2 protease
    Species: Human immunodeficiency virus 2 [TaxId:11709]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04584 (0-98)
      • conflict (56)
    Domains in SCOPe 2.05: d2hpeb_
  • Chain 'S':
    Compound: unidentified peptide fragment
    Database cross-references and differences (RAF-indexed):
    • PDB 2HPE (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpeA (A:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpeB (B:)
    pqfslwkrpvvtayiegqpvevlldtgaddsivagielgnnyspkivggiggfintleyk
    nveievlnkkvratimtgdtpinifgrniltalgmslnl
    

  • Chain 'S':
    No sequence available.