PDB entry 2hhu

View 2hhu on RCSB PDB site
Description: C:O6-methyl-guanine in the polymerase postinsertion site (-1 basepair position)
Class: Transferase/DNA
Keywords: DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine, Transferase-DNA COMPLEX
Deposited on 2006-06-28, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hhua1, d2hhua2
  • Chain 'B':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*ap*gp*cp*cp*c)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*gp*tp*ap*cp*(6og)p*gp*gp*cp*tp*gp*ap*tp*cp*gp*cp*a)-3'
    Species: synthetic, synthetic
  • Heterogens: SUC, SO4, MG, DCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hhuA (A:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.