PDB entry 2hb4

View 2hb4 on RCSB PDB site
Description: Structure of HIV Protease NL4-3 in an Unliganded State
Class: hydrolase
Keywords: HIV, protease, aspartyl, retrovirus, HYDROLASE
Deposited on 2006-06-13, released 2007-06-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.238
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • engineered (6)
  Domains in SCOPe 2.02: d2hb4a_
• Heterogens: MG, PGR, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hb4A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf