PDB entry 2h3l

View 2h3l on RCSB PDB site
Description: Crystal Structure of ERBIN PDZ
Class: cell adhesion
Keywords: PDZ Domain, CELL ADHESION
Deposited on 2006-05-22, released 2006-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LAP2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBIN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96RT1 (4-102)
      • cloning artifact (0-3)
    Domains in SCOPe 2.08: d2h3la2, d2h3la3
  • Chain 'B':
    Compound: LAP2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2h3lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2h3lA (A:)
    gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
    qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h3lB (B:)
    gshmghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskll
    qpgdkiiqangysfiniehgqavsllktfqntveliivrevss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h3lB (B:)
    ghelakqeirvrvekdpelgfsisggvggrgnpfrpdddgifvtrvqpegpaskllqpgd
    kiiqangysfiniehgqavsllktfqntveliivrevs