PDB entry 2gsg

View 2gsg on RCSB PDB site
Description: Crystal structure of the Fv fragment of a monoclonal antibody specific for poly-glutamine
Class: immune system
Keywords: Fv, monoclonal antibody, poly-glutamine, IMMUNE SYSTEM
Deposited on 2006-04-26, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.229
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monoclonal antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GSG (0-End)
    Domains in SCOPe 2.07: d2gsga_
  • Chain 'B':
    Compound: monoclonal antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GSG (0-117)
    Domains in SCOPe 2.07: d2gsgb1, d2gsgb2
  • Chain 'C':
    Compound: monoclonal antibody light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GSG (0-End)
    Domains in SCOPe 2.07: d2gsgc_
  • Chain 'D':
    Compound: monoclonal antibody heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2GSG (0-117)
    Domains in SCOPe 2.07: d2gsgd1, d2gsgd2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gsgA (A:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsgA (A:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsgB (B:)
    qvqlqesggglvqpggslklscaasgftfrdyymywvrqtpekrlewvafisngggstyy
    pdtvkgrftisrdnakntlylqmsrlksedtamyycargrgyvwfaywgqgttvtvss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gsgC (C:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gsgC (C:)
    qlvltqsssasfslgasakltctlssqhstytiewyqqqplkppkyvmelkkdgshstgd
    gipdrfsgsssgadrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2gsgD (D:)
    qvqlqesggglvqpggslklscaasgftfrdyymywvrqtpekrlewvafisngggstyy
    pdtvkgrftisrdnakntlylqmsrlksedtamyycargrgyvwfaywgqgttvtvss