PDB entry 2gb1

View 2gb1 on RCSB PDB site
Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1991-05-15, released 1993-04-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2gb1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2gb1A (A:)
mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte