PDB entry 2g89

View 2g89 on RCSB PDB site
Description: L. casei thymidylate synthase Y261A in complex with substrate, dUMP
Class: transferase
Keywords: alpha/beta protein, beta sheet, dUMP-binding residue, dUMP complex, active site mutation, TRANSFERASE
Deposited on 2006-03-02, released 2006-03-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.182
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Lactobacillus casei [TaxId:1582]
    Gene: thyA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00469 (0-315)
      • engineered (260)
    Domains in SCOPe 2.05: d2g89a_
  • Heterogens: UMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2g89A (A:)
mleqpyldlakkvldeghfkpdrthtgtysifghqmrfdlskgfpllttkkvpfglikse
llwflhgdtnirfllqhrnhiwdewafekwvksdeyhgpdmtdfghrsqkdpefaavyhe
emakfddrvlhddafaakygdlglvygsqwrawhtskgdtidqlgdvieqikthpysrrl
ivsawnpedvptmalppchtlyqfyvndgklslqlyqrsadiflgvpfniasyallthlv
ahecglevgefihtfgdahlavnhldqikeqlsrtprpaptlqlnpdkhdifdfdmkdik
llnydpypaikapvav