PDB entry 2g69

View 2g69 on RCSB PDB site
Description: Structure of Unliganded HIV-1 Protease F53L Mutant
Class: hydrolase
Keywords: aspartic protease, catalysis, unliganded, flap mutant, non-active site mutant, HYDROLASE
Deposited on 2006-02-24, released 2006-05-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.164
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03368 (0-98)
    • engineered (6)
    • engineered (32)
    • engineered (52)
    • engineered (62)
    • engineered (66)
    • engineered (94)
  Domains in SCOPe 2.01: d2g69a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2g69A (A:)
  pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggigglikvrqyd
  qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf