PDB entry 2g4s

View 2g4s on RCSB PDB site
Description: Anomalous substructure of NBR1PB1
Class: metal binding protein
Keywords: anomalous substructure of NBR1PB1, METAL BINDING PROTEIN
Deposited on 2006-02-22, released 2007-02-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.216
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Next to BRCA1 gene 1 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: NBR1,1A13B, KIAA0049, M17S2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14596 (1-85)
      • cloning artifact (0)
    Domains in SCOPe 2.08: d2g4sa1, d2g4sa2
  • Heterogens: CL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2g4sA (A:)
    amepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevsin
    sqgeyeealkmavkqgnqlqmqvheg