PDB entry 2fnt
View 2fnt on RCSB PDB site
Description: Crystal structure of a drug-resistant (V82A) inactive (D25N) HIV-1 protease complexed with AP2V variant of HIV-1 NC-p1 substrate.
Class: hydrolase
Keywords: structural intermediate, substrate recognition, hiv-1 protease, NC-p1 substrate, drug resistance, flap conformation, HYDROLASE
Deposited on
2006-01-11, released
2006-09-05
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.188
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot O38716 (0-98)
- engineered (6)
- engineered (24)
- engineered (63)
- engineered (81)
Domains in SCOPe 2.01: d2fnta_ - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot O38716 (0-98)
- engineered (6)
- engineered (24)
- engineered (63)
- engineered (81)
Domains in SCOPe 2.01: d2fntb_ - Chain 'P':
Compound: nc-p1 substrate peptide
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: PO4, ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2fntA (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2fntB (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'P':
No sequence available.