PDB entry 2fle
View 2fle on RCSB PDB site
Description: Structural analysis of asymmetric inhibitor bound to the HIV-1 Protease V82A mutant
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, inhibitor, resistance, induced fit, hydrolase-hydrolase inhibitor COMPLEX
Deposited on
2006-01-05, released
2007-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.48
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: pol protein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2flea_ - Chain 'B':
Compound: pol protein
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2fleb_ - Heterogens: AI, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2fleA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgkwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2fleB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgkwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpaniigrnlltqigctlnf