PDB entry 2fle

View 2fle on RCSB PDB site
Description: Structural analysis of asymmetric inhibitor bound to the HIV-1 Protease V82A mutant
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, inhibitor, resistance, induced fit, hydrolase-hydrolase inhibitor COMPLEX
Deposited on 2006-01-05, released 2007-01-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • GB AAO73975 (0-98)
      • engineered (81)
    Domains in SCOPe 2.01: d2flea_
  • Chain 'B':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • GB AAO73975 (0-98)
      • engineered (81)
    Domains in SCOPe 2.01: d2fleb_
  • Heterogens: AI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fleA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgkwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2fleB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgkwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf