PDB entry 2fgu

View 2fgu on RCSB PDB site
Description: X-ray crystal structure of HIV-1 Protease T80S variant in complex with the inhibitor saquinavir used to explore the role of invariant Thr80 in HIV-1 protease structure, function, and viral infectivity.
Class: hydrolase
Keywords: HIV Protease, drug resistance, enzyme kinetics, sequence conservation, protein structure, HYDROLASE
Deposited on 2005-12-22, released 2006-11-07
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • engineered (6)
    • engineered (63)
    • engineered (79)
  Domains in SCOPe 2.02: d2fgua_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: GAG
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38716 (0-98)
    • engineered (6)
    • engineered (63)
    • engineered (79)
  Domains in SCOPe 2.02: d2fgub_
• Heterogens: PO4, QNC, DIQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fguA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgpspvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2fguB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipveicghkaigtvlvgpspvniigrnlltqigctlnf