PDB entry 2f5y

View 2f5y on RCSB PDB site
Description: Crystal Structure of the PDZ Domain from Human RGS-3
Class: signaling protein
Keywords: PDZ Domain, RGS-3, Human, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN
Deposited on 2005-11-28, released 2005-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulator of G-protein signalling 3 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49796 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d2f5ya1, d2f5ya2
  • Chain 'B':
    Compound: regulator of G-protein signalling 3 isoform 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49796 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.06: d2f5yb2, d2f5yb3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2f5yA (A:)
smryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwk
cvelaheirscpseiillvwrmvpqvkpgpd

    Sequence, based on observed residues (ATOM records): (download) 
    >2f5yA (A:)
mryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkc
velaheirscpseiillvwrmv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2f5yB (B:)
smryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwk
cvelaheirscpseiillvwrmvpqvkpgpd

    Sequence, based on observed residues (ATOM records): (download) 
    >2f5yB (B:)
mryrqitiprgkdgfgfticcdspvrvqavdsggpaeraglqqldtvlqlnerpvehwkc
velaheirscpseiillvwrmv