PDB entry 2esw

View 2esw on RCSB PDB site
Description: Atomic structure of the N-terminal SH3 domain of mouse beta PIX,p21-activated kinase (PAK)-interacting exchange factor
Class: signaling protein
Keywords: beta barrel, sh3 domain, signaling protein
Deposited on 2005-10-27, released 2006-04-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ES28 (4-60)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d2eswa1, d2eswa2
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2eswb_
  • Heterogens: HG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2eswA (A:)
    gplgsqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eswA (A:)
    plgsqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2eswB (B:)
    gplgsqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvre
    i
    

    Sequence, based on observed residues (ATOM records): (download)
    >2eswB (B:)
    sqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegthngrtgwfpsnyvrei