PDB entry 2eno

View 2eno on RCSB PDB site
Description: Solution structure of the PDZ domain from human Synaptojanin 2 binding protein
Class: endocytosis
Keywords: Mitochondrial outer membrane protein 25, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS
Deposited on 2007-03-28, released 2007-10-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptojanin-2-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SYNJ2BP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P57105 (7-113)
      • expression tag (0-6)
      • expression tag (114-119)
    Domains in SCOPe 2.05: d2enoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2enoA (A:)
gssgssgmngrvdylvteeeinltrgpsglgfnivggtdqqyvsndsgiyvsrikengaa
aldgrlqegdkilsvngqdlknllhqdavdlfrnagyavslrvqhrlqvqngpisgpssg