PDB entry 2edp

View 2edp on RCSB PDB site
Description: Solution structure of the PDZ domain from human Shroom family member 4
Class: structural protein
Keywords: APX/Shroom family member, KIAA1202 protein, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2007-02-14, released 2007-08-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shroom family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1202
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULL8 (7-93)
      • cloning artifact (0-6)
      • cloning artifact (94-99)
    Domains in SCOPe 2.05: d2edpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2edpA (A:)
    gssgssggsfqyvpvqlqggapwgftlkgglehcepltvskiedggkaalsqkmrtgdel
    vningtplygsrqealilikgsfrilklivrrrnsgpssg